PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.9KG317700.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family GRAS
Protein Properties Length: 646aa    MW: 67055.8 Da    PI: 6.4757
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.9KG317700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS288.32.1e-882866442374
                 GRAS   2 velLlecAeavssgdlelaqalLarlsel...aspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevs 88 
                          v++L e+A+  ++gd+  a+++Larl+ +   +  +g+p+ R a+yf+eAL+  l+     + +a +p+ +++++++ +l a+k+fsevs
  Pavir.9KG317700.1.p 286 VDQLAEAAKLAEAGDAFGAREILARLNYRlpaVPAAGTPLLRSAFYFKEALRLALSP----TGEAPAPQVSTPYDVVLKLGAYKAFSEVS 371
                          689*************************999445566******************99....889999999999***************** PP

                 GRAS  89 PilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfef 178
                          P+l+f+hlt+ qa+l+++ g+ r+H++Dfdi++G QW++L+q+La+R  ++++l++T+++s+++++  el+ ++e+La fA+elgv ++f
  Pavir.9KG317700.1.p 372 PVLQFAHLTCVQAVLDEIGGAGRIHVLDFDIGMGEQWASLMQELAQR-CPAATLKVTALVSSATHHPLELQLIHENLAGFAAELGVFLQF 460
                          **********************************************9.7889*********9999************************* PP

                 GRAS 179 nvlvakrledleleeL.rvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysal 267
                           v+   +l++l++ eL ++ +g+a+aV+l +   ++         + ++vL+lvk+l +kvvv v++  d+++ +F++++++a++ +++l
  Pavir.9KG317700.1.p 461 AVF---NLDTLDPAELvAITSGDAVAVHLPVGSAHVA--------AMPAVLRLVKRLGAKVVVSVDHGGDRTELPFAAHLFQAFQSCVSL 539
                          **9...999***999945566***********99998........4566***************************************** PP

                 GRAS 268 fdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgs 357
                          ++s++a   +++++ +k+Er+l+++ ++  v +++++  +  +    Wr  + +aGF pv+ s++a++qa++ll++++  g+rve++ g+
  Pavir.9KG317700.1.p 540 LESVDAV-RPDADAVAKMERFLVQPGVERRVVARHRA-AAMDKPPPPWRTVFAAAGFVPVQASTFAESQAEALLKRMALMGFRVEKRGGA 627
                          ****998.6788999**************99999998.7778889********************************************* PP

                 GRAS 358 lvlgWkdrpLvsvSaWr 374
                          l+l+W++ +LvsvSaWr
  Pavir.9KG317700.1.p 628 LCLYWQRGELVSVSAWR 644
                          ****************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098539.987259624IPR005202Transcription factor GRAS
PfamPF035147.3E-86286644IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 646 aa     Download sequence    Send to blast
MRGMLFAGSA REGHAGTLLL LQQQQQQQGL AAGKVSGAGG LWEPTSVLDH RHSPSPSPPT  60
SASTLSSPLG AATAGVAALA GANAKNVSPP PPAGAWPGGA AAEEAAVGGK EEWQLTPLDM  120
GLGAGEGWDA AGSVLSDGAA PPGLAPDHTF LRWIIGGEDA SAGMGAVMDP AVLELDHAPS  180
MMSPAFGSSM PFAPAMEDTK APPFAHASNL LLHHHQHHPQ PHAAFFGSHP SLDAAPPTPK  240
RHHPMAPAPA PKLQSLPGPA APAAGFVPAM KPKAEAAAND EAAAAVDQLA EAAKLAEAGD  300
AFGAREILAR LNYRLPAVPA AGTPLLRSAF YFKEALRLAL SPTGEAPAPQ VSTPYDVVLK  360
LGAYKAFSEV SPVLQFAHLT CVQAVLDEIG GAGRIHVLDF DIGMGEQWAS LMQELAQRCP  420
AATLKVTALV SSATHHPLEL QLIHENLAGF AAELGVFLQF AVFNLDTLDP AELVAITSGD  480
AVAVHLPVGS AHVAAMPAVL RLVKRLGAKV VVSVDHGGDR TELPFAAHLF QAFQSCVSLL  540
ESVDAVRPDA DAVAKMERFL VQPGVERRVV ARHRAAAMDK PPPPWRTVFA AAGFVPVQAS  600
TFAESQAEAL LKRMALMGFR VEKRGGALCL YWQRGELVSV SAWRC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-2532164436375GRAS family transcription factor containing p
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pvr.42270.0callus| leaf| stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7277570.0KJ727757.1 Zea mays clone pUT5701 GRAS transcription factor (GRAS33) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004983723.10.0PREDICTED: scarecrow-like protein 6 isoform X1
TrEMBLK4AJM70.0K4AJM7_SETIT; Uncharacterized protein
STRINGSi039098m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP67232954
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00150.19e-83GRAS family protein